Lineage for d2ktqa1 (2ktq A:295-422)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 316908Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
    consists of one domain of this fold
  5. 317107Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (6 proteins)
  6. 317130Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 317158Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries)
  8. 317166Domain d2ktqa1: 2ktq A:295-422 [33702]
    Other proteins in same PDB: d2ktqa2
    complexed with ctp, ddc, mg

Details for d2ktqa1

PDB Entry: 2ktq (more details), 2.3 Å

PDB Description: open ternary complex of the large fragment of dna polymerase i from thermus aquaticus

SCOP Domain Sequences for d2ktqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ktqa1 c.55.3.5 (A:295-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus}
eeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargllak
dlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlfa
nlwgrleg

SCOP Domain Coordinates for d2ktqa1:

Click to download the PDB-style file with coordinates for d2ktqa1.
(The format of our PDB-style files is described here.)

Timeline for d2ktqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ktqa2