SCOP 1.65: Domain d2ktqa1: 2ktq A:295-422

Lineage for d2ktqa1 (2ktq A:295-422)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (6 proteins)

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries)

8. Domain d2ktqa1: 2ktq A:295-422 [33702]
   Other proteins in same PDB: d2ktqa2
   complexed with ctp, ddc, mg

Details for d2ktqa1

PDB Entry: 2ktq, 2.3 Å

PDB Description: open ternary complex of the large fragment of dna polymerase i from thermus aquaticus

SCOP Domain Sequences for d2ktqa1:

Sequence; same for both SEQRES and ATOM records:

>d2ktqa1 c.55.3.5 (A:295-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus}
eeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargllak
dlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlfa
nlwgrleg

Timeline for d2ktqa1:

• d2ktqa1 first appeared (with stable ids) in SCOP 1.55
  
• d2ktqa1 appears in SCOP 1.63
  
• d2ktqa1 appears in SCOP 1.67
  
• d2ktqa1 appears in the current release, SCOPe 2.08