Lineage for d5neba1 (5neb A:2-256)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163929Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (101 PDB entries)
  8. 2164076Domain d5neba1: 5neb A:2-256 [337011]
    Other proteins in same PDB: d5neba2, d5nebb2
    automated match to d4mf3a_
    complexed with 8ve, act, cl, gol, so4

Details for d5neba1

PDB Entry: 5neb (more details), 2.05 Å

PDB Description: structure of gluk1 ligand-binding domain (s1s2) in complex with lm-12b at 2.05 a resolution
PDB Compounds: (A:) Glutamate receptor ionotropic, kainate 1

SCOPe Domain Sequences for d5neba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5neba1 c.94.1.0 (A:2-256) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
anrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgky
gaqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpid
saddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvl
ttdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeeg
klhmmkekwwrgngc

SCOPe Domain Coordinates for d5neba1:

Click to download the PDB-style file with coordinates for d5neba1.
(The format of our PDB-style files is described here.)

Timeline for d5neba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5neba2