SCOPe 2.06: Domain d5mxua2: 5mxu A:274-560

Lineage for d5mxua2 (5mxu A:274-560)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families)
   duplication: contains two subdomains of this fold

5. Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins)
   automatically mapped to Pfam PF02913

6. Protein automated matches [254446] (2 species)
   not a true protein

7. Species Penicillium simplicissimum [TaxId:69488] [336991] (2 PDB entries)

8. Domain d5mxua2: 5mxu A:274-560 [336994]
   Other proteins in same PDB: d5mxua1, d5mxub1
   automated match to d1vaoa1
   complexed with fad, gol; mutant

Details for d5mxua2

PDB Entry: 5mxu, 2.8 Å

PDB Description: structure of the y503f mutant of vanillyl alcohol oxidase

PDB Compounds: (A:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d5mxua2:

Sequence; same for both SEQRES and ATOM records:

>d5mxua2 d.58.32.1 (A:274-560) automated matches {Penicillium simplicissimum [TaxId: 69488]}
rgyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhilldaavlgdkrsyssrtep
lsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdafsaipgvkfyfpedtpens
vlrvrdktmqgiptydelkwidwlpngahlffspiakvsgedammqyavtkkrcqeagld
figtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddcaangwgefrthlafmdqi
metynwnnssflrfnevlknavdpngiiapgksgvwpsqyshvtwkl

Timeline for d5mxua2:

• d5mxua2 is new in SCOPe 2.06-stable
  
• d5mxua2 appears in SCOPe 2.07
  
• d5mxua2 appears in the current release, SCOPe 2.08