|  | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) | 
|  | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest | 
|  | Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)  consists of one domain of this fold | 
|  | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins) | 
|  | Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF | 
|  | Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries) | 
|  | Domain d1qssa1: 1qss A:293-422 [33697] Other proteins in same PDB: d1qssa2 | 
PDB Entry: 1qss (more details), 2.3 Å
SCOP Domain Sequences for d1qssa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qssa1 c.55.3.5 (A:293-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus}
aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeergll
akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl
fanlwgrleg
Timeline for d1qssa1: