SCOP 1.65: Domain d1kfd_1: 1kfd 324-518

Lineage for d1kfd_1 (1kfd 324-518)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (6 proteins)

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)

8. Domain d1kfd_1: 1kfd 324-518 [33694]
   Other proteins in same PDB: d1kfd_2
   complexed with ctp

Details for d1kfd_1

PDB Entry: 1kfd, 3.9 Å

PDB Description: crystal structures of the klenow fragment of dna polymerase i complexed with deoxynucleoside triphosphate and pyrophosphate

SCOP Domain Sequences for d1kfd_1:

Sequence; same for both SEQRES and ATOM records:

>d1kfd_1 c.55.3.5 (324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli}
visydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk

Timeline for d1kfd_1:

• d1kfd_1 first appeared (with stable ids) in SCOP 1.55
  
• d1kfd_1 appears in SCOP 1.63
  
• d1kfd_1 appears in SCOP 1.67
  
• d1kfd_1 appears in the current release, SCOPe 2.08, called d1kfda1