|  | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) | 
|  | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest | 
|  | Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)  consists of one domain of this fold | 
|  | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (5 proteins) | 
|  | Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF | 
|  | Species Escherichia coli [TaxId:562] [53120] (14 PDB entries) | 
|  | Domain d1klna1: 1kln A:324-518 [33693] Other proteins in same PDB: d1klna2 protein/DNA complex; complexed with zn; mutant | 
PDB Entry: 1kln (more details), 3.2 Å
SCOP Domain Sequences for d1klna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1klna1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli}
visydnyvtildeetlkawiaklekapvfafatetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk
Timeline for d1klna1: