Lineage for d1dpi_1 (1dpi 326-518)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124495Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
  5. 124680Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)
  6. 124703Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
  7. 124709Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)
  8. 124721Domain d1dpi_1: 1dpi 326-518 [33692]
    Other proteins in same PDB: d1dpi_2

Details for d1dpi_1

PDB Entry: 1dpi (more details), 2.8 Å

PDB Description: structure of large fragment of escherichia coli dna polymerase i complexed with d/tmp

SCOP Domain Sequences for d1dpi_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpi_1 c.55.3.5 (326-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli}
sydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayipv
ahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtmle
syilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedadvt
lqlhlkmwpdlqk

SCOP Domain Coordinates for d1dpi_1:

Click to download the PDB-style file with coordinates for d1dpi_1.
(The format of our PDB-style files is described here.)

Timeline for d1dpi_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dpi_2