Lineage for d1qsla1 (1qsl A:324-518)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245987Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 246267Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
    consists of one domain of this fold
  5. 246466Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (5 proteins)
  6. 246489Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 246495Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)
  8. 246503Domain d1qsla1: 1qsl A:324-518 [33686]
    Other proteins in same PDB: d1qsla2
    complexed with eu; mutant

Details for d1qsla1

PDB Entry: 1qsl (more details), 2.2 Å

PDB Description: klenow fragment complexed with single-stranded substrate and europium (iii) ion

SCOP Domain Sequences for d1qsla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsla1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk

SCOP Domain Coordinates for d1qsla1:

Click to download the PDB-style file with coordinates for d1qsla1.
(The format of our PDB-style files is described here.)

Timeline for d1qsla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qsla2