Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.106: SurE-like [64166] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7 |
Superfamily c.106.1: SurE-like [64167] (2 families) some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family |
Family c.106.1.0: automated matches [191430] (1 protein) not a true family |
Protein automated matches [190619] (7 species) not a true protein |
Species Xylella fastidiosa [TaxId:160492] [336804] (4 PDB entries) |
Domain d5ksrd_: 5ksr D: [336821] automated match to d2v4na_ complexed with cl, iod, mn |
PDB Entry: 5ksr (more details), 1.96 Å
SCOPe Domain Sequences for d5ksrd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ksrd_ c.106.1.0 (D:) automated matches {Xylella fastidiosa [TaxId: 160492]} mrvlvsnddgvdapgikiladalrnaghevmvvapdrdrsgasnsltldtpirakqidmh tysvagtptdcvhlaltgllnydpdivvsginntgnlgddviysgtvsaamegrflglpa vavslvtlyregqqapqyetaahaainivaqlktdplpadtilnvnvpdvtwqqmrgfkv trlgnrhrsapcltqtdprghtiywigpagpeqdagpgtdfdavrntyisitpihvdltr yqalenvtrwtdrltahmd
Timeline for d5ksrd_: