Lineage for d5ksrd_ (5ksr D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526572Fold c.106: SurE-like [64166] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7
  4. 2526573Superfamily c.106.1: SurE-like [64167] (2 families) (S)
    some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family
  5. 2526589Family c.106.1.0: automated matches [191430] (1 protein)
    not a true family
  6. 2526590Protein automated matches [190619] (7 species)
    not a true protein
  7. 2526670Species Xylella fastidiosa [TaxId:160492] [336804] (4 PDB entries)
  8. 2526674Domain d5ksrd_: 5ksr D: [336821]
    automated match to d2v4na_
    complexed with cl, iod, mn

Details for d5ksrd_

PDB Entry: 5ksr (more details), 1.96 Å

PDB Description: stationary phase survival protein e (sure) from xylella fastidiosa - xfsure-tb (tetramer bigger).
PDB Compounds: (D:) 5'-nucleotidase sure

SCOPe Domain Sequences for d5ksrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksrd_ c.106.1.0 (D:) automated matches {Xylella fastidiosa [TaxId: 160492]}
mrvlvsnddgvdapgikiladalrnaghevmvvapdrdrsgasnsltldtpirakqidmh
tysvagtptdcvhlaltgllnydpdivvsginntgnlgddviysgtvsaamegrflglpa
vavslvtlyregqqapqyetaahaainivaqlktdplpadtilnvnvpdvtwqqmrgfkv
trlgnrhrsapcltqtdprghtiywigpagpeqdagpgtdfdavrntyisitpihvdltr
yqalenvtrwtdrltahmd

SCOPe Domain Coordinates for d5ksrd_:

Click to download the PDB-style file with coordinates for d5ksrd_.
(The format of our PDB-style files is described here.)

Timeline for d5ksrd_: