Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein) |
Protein Retroviral integrase, catalytic domain [53108] (3 species) |
Species Rous sarcoma virus (RSV, avian sarcoma virus) [53109] (21 PDB entries) |
Domain d1vsma_: 1vsm A: [33635] |
PDB Entry: 1vsm (more details), 2.15 Å
SCOP Domain Sequences for d1vsma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsma_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)} glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg dgfmkriptskqgellakamyalnhf
Timeline for d1vsma_: