SCOP 1.71: Domain d1vsma_: 1vsm A:

Lineage for d1vsma_ (1vsm A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Rous sarcoma virus (RSV, avian sarcoma virus) [53109] (21 PDB entries)

8. Domain d1vsma_: 1vsm A: [33635]

Details for d1vsma_

PDB Entry: 1vsm, 2.15 Å

PDB Description: asv integrase core domain in citrate buffer ph 5.0

SCOP Domain Sequences for d1vsma_:

Sequence; same for both SEQRES and ATOM records:

>d1vsma_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)}
glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
dgfmkriptskqgellakamyalnhf

Timeline for d1vsma_:

• d1vsma_ first appeared (with stable ids) in SCOP 1.55
  
• d1vsma_ appears in SCOP 1.69
  
• d1vsma_ appears in SCOP 1.73
  
• d1vsma_ appears in the current release, SCOPe 2.08