SCOPe 2.08: Domain d5lwlb1: 5lwl B:2-121

Lineage for d5lwlb1 (5lwl B:2-121)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Lactobacillus paracasei [TaxId:1597] [336049] (2 PDB entries)

8. Domain d5lwlb1: 5lwl B:2-121 [336149]
   Other proteins in same PDB: d5lwla2, d5lwlb2
   automated match to d4q7ea_
   complexed with so4; mutant

Details for d5lwlb1

PDB Entry: 5lwl, 3.1 Å

PDB Description: maer d54a mutant response regulator bound to sulfate

PDB Compounds: (B:) transcriptional regulatory protein

SCOPe Domain Sequences for d5lwlb1:

Sequence; same for both SEQRES and ATOM records:

>d5lwlb1 c.23.1.0 (B:2-121) automated matches {Lactobacillus paracasei [TaxId: 1597]}
tniliveddpmvqfihrnylekigtfdtiyssetiadakkllasrsiqlvllairlkdgn
gidfltdlrrtkqtvdvilitaanevnivndalhlgvidylikpftlerfeksiqryrtk

Timeline for d5lwlb1:

• d5lwlb1 first appeared in SCOPe 2.06
  
• d5lwlb1 appears in SCOPe 2.07