Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (71 species) not a true protein |
Species Lactobacillus paracasei [TaxId:1597] [336049] (2 PDB entries) |
Domain d5lwlb1: 5lwl B:2-121 [336149] Other proteins in same PDB: d5lwla2, d5lwlb2 automated match to d4q7ea_ complexed with so4; mutant |
PDB Entry: 5lwl (more details), 3.1 Å
SCOPe Domain Sequences for d5lwlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lwlb1 c.23.1.0 (B:2-121) automated matches {Lactobacillus paracasei [TaxId: 1597]} tniliveddpmvqfihrnylekigtfdtiyssetiadakkllasrsiqlvllairlkdgn gidfltdlrrtkqtvdvilitaanevnivndalhlgvidylikpftlerfeksiqryrtk
Timeline for d5lwlb1: