Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (86 species) not a true protein |
Species Lactobacillus paracasei [TaxId:1597] [336049] (2 PDB entries) |
Domain d5lwkb_: 5lwk B: [336104] automated match to d1zh4a_ complexed with bef, mg |
PDB Entry: 5lwk (more details), 2.11 Å
SCOPe Domain Sequences for d5lwkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lwkb_ c.23.1.0 (B:) automated matches {Lactobacillus paracasei [TaxId: 1597]} mtniliveddpmvqfihrnylekigtfdtiyssetiadakkllasrsiqlvlldirlkdg ngidfltdlrrtkqtvdvilitaanevnivndalhlgvidylikpftlerfeksiqryrt kh
Timeline for d5lwkb_: