Lineage for d5lwkb_ (5lwk B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856003Species Lactobacillus paracasei [TaxId:1597] [336049] (2 PDB entries)
  8. 2856005Domain d5lwkb_: 5lwk B: [336104]
    automated match to d1zh4a_
    complexed with bef, mg

Details for d5lwkb_

PDB Entry: 5lwk (more details), 2.11 Å

PDB Description: maer response regulator bound to beryllium trifluoride
PDB Compounds: (B:) transcriptional regulatory protein

SCOPe Domain Sequences for d5lwkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lwkb_ c.23.1.0 (B:) automated matches {Lactobacillus paracasei [TaxId: 1597]}
mtniliveddpmvqfihrnylekigtfdtiyssetiadakkllasrsiqlvlldirlkdg
ngidfltdlrrtkqtvdvilitaanevnivndalhlgvidylikpftlerfeksiqryrt
kh

SCOPe Domain Coordinates for d5lwkb_:

Click to download the PDB-style file with coordinates for d5lwkb_.
(The format of our PDB-style files is described here.)

Timeline for d5lwkb_: