Lineage for d1zh4a_ (1zh4 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (8 families) 
Family c.23.1.0: automated matches [191324] (1 protein)
not a true familyProtein automated matches [190131] (86 species)
not a true protein
Species Escherichia coli [TaxId:562] [186855] (10 PDB entries) 
Domain d1zh4a_: 1zh4 A: [125071]
automated match to d1mvoa_
complexed with bef, mg
Details for d1zh4a_
PDB Entry: 1zh4 (more details), 2.2 Å
PDB Description: crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe
PDB Compounds: (A:) KDP operon transcriptional regulatory protein kdpESCOPe Domain Sequences for d1zh4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zh4a_ c.23.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mtnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdg
iefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhs
q
SCOPe Domain Coordinates for d1zh4a_:
Click to download the PDB-style file with coordinates for d1zh4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zh4a_:
- d1zh4a_ first appeared in SCOP 1.73, called d1zh4a1
- d1zh4a_ appears in SCOPe 2.07
View in 3D
