Lineage for d1zh4a_ (1zh4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855951Species Escherichia coli [TaxId:562] [186855] (10 PDB entries)
  8. 2855963Domain d1zh4a_: 1zh4 A: [125071]
    automated match to d1mvoa_
    complexed with bef, mg

Details for d1zh4a_

PDB Entry: 1zh4 (more details), 2.2 Å

PDB Description: crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe
PDB Compounds: (A:) KDP operon transcriptional regulatory protein kdpE

SCOPe Domain Sequences for d1zh4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zh4a_ c.23.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mtnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdg
iefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhs
q

SCOPe Domain Coordinates for d1zh4a_:

Click to download the PDB-style file with coordinates for d1zh4a_.
(The format of our PDB-style files is described here.)

Timeline for d1zh4a_: