SCOP 1.73: Domain d1zh4a1: 1zh4 A:2-120

Lineage for d1zh4a1 (1zh4 A:2-120)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein Transcriptional regulatory protein KdpE, N-terminal domain [142025] (1 species)

7. Species Escherichia coli [TaxId:562] [142026] (2 PDB entries)

8. Domain d1zh4a1: 1zh4 A:2-120 [125071]
   automatically matched to 1ZH2 A:2-120
   complexed with bef, mg; mutant

Details for d1zh4a1

PDB Entry: 1zh4, 2.2 Å

PDB Description: crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe

PDB Compounds: (A:) KDP operon transcriptional regulatory protein kdpE

SCOP Domain Sequences for d1zh4a1:

Sequence; same for both SEQRES and ATOM records:

>d1zh4a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]}
tnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdgi
efirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhs

Timeline for d1zh4a1:

• d1zh4a1 is new in SCOP 1.73
  
• d1zh4a1 appears in SCOP 1.75
  
• d1zh4a1 appears in the current release, SCOPe 2.08, called d1zh4a_