SCOPe 2.07: Domain d5lhna_: 5lhn A:

Lineage for d5lhna_ (5lhn A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (88 PDB entries)
   Uniprot P00749 156-178,179-424

8. Domain d5lhna_: 5lhn A: [336070]
   Other proteins in same PDB: d5lhnb1, d5lhnb2
   automated match to d3mwiu_
   complexed with edo, so4

Details for d5lhna_

PDB Entry: 5lhn, 2.55 Å

PDB Description: the catalytic domain of murine urokinase-type plasminogen activator in complex with the allosteric inhibitory nanobody nb7

PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d5lhna_:

Sequence, based on SEQRES records:

>d5lhna_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ivggeftevenqpwfaaiyqknkggsppsfkcggslispcwvasaahcfiqlpkkenyvv
ylgqskessynpgemkfeveqlilheyyredslayhndiallkirtstgqcaqpsrsiqt
ialpprftdapfgsdceitgfgkesesdylypknlkmsvvklvsheqcmqphyygseiny
kmlcaadpewktdsckgdsggplicniegrptlsgivswgrgcaeknkpgvytrvshfld
wiqshig

Sequence, based on observed residues (ATOM records):

>d5lhna_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ivggeftevenqpwfaaiyqknkggsppsfkcggslispcwvasaahcfiqlpkkenyvv
ylgqskessynpgemkfeveqlilheyyredslayhndiallkirtstgqcaqpsrsiqt
ialpprftdapfgsdceitgfgkknlkmsvvklvsheqcmqphyygseinykmlcaadpe
wktdsckgdsggplicniegrptlsgivswgrgcaeknkpgvytrvshfldwiqshig

Timeline for d5lhna_:

• d5lhna_ first appeared in SCOPe 2.06
  
• d5lhna_ appears in the current release, SCOPe 2.08