SCOPe 2.07: Domain d5h7bb4: 5h7b B:177-228

Lineage for d5h7bb4 (5h7b B:177-228)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
   automatically mapped to Pfam PF02216

6. Protein Immunoglobulin-binding protein A modules [46999] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [47000] (24 PDB entries)

8. Domain d5h7bb4: 5h7b B:177-228 [336030]
   automated match to d2otke_

Details for d5h7bb4

PDB Entry: 5h7b, 3.1 Å

PDB Description: crystal structure of a repeat protein with five protein a repeat modules

PDB Compounds: (B:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d5h7bb4:

Sequence; same for both SEQRES and ATOM records:

>d5h7bb4 a.8.1.1 (B:177-228) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
afyeilhlpnlneeqrnafiqslkddpsqsanllaeakklneqqaafyeilh

Timeline for d5h7bb4:

• d5h7bb4 first appeared in SCOPe 2.06
  
• d5h7bb4 appears in the current release, SCOPe 2.08