Lineage for d5gj3a1 (5gj3 A:96-360)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912730Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2912731Protein automated matches [190944] (40 species)
    not a true protein
  7. 2912820Species Roseiflexus sp. [TaxId:357808] [335988] (2 PDB entries)
  8. 2912821Domain d5gj3a1: 5gj3 A:96-360 [335989]
    Other proteins in same PDB: d5gj3a2
    automated match to d2r7ab_
    complexed with hem, zn

Details for d5gj3a1

PDB Entry: 5gj3 (more details), 2 Å

PDB Description: periplasmic heme-binding protein rhut from roseiflexus sp. rs-1 in two-heme bound form (holo-2)
PDB Compounds: (A:) periplasmic binding protein

SCOPe Domain Sequences for d5gj3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gj3a1 c.92.2.0 (A:96-360) automated matches {Roseiflexus sp. [TaxId: 357808]}
erivslngditeiifalgmgeyvvgvdssatyppertkmlpnigyqrrlsaegilslnpt
lvigdeaagppetlaqiraagvplaitadppsldapqqkirfvaqalgipqrgerlaaqv
eaeiaaardlarritnpphvlflylrgtdvqqvagrntavdvmiaaagginaaadagive
fkplspevviaaqpdvllvldkglesvggvdgllkipgladtpagrqrriialddlyllg
mgprtgqaltdltiafydaaqgsrp

SCOPe Domain Coordinates for d5gj3a1:

Click to download the PDB-style file with coordinates for d5gj3a1.
(The format of our PDB-style files is described here.)

Timeline for d5gj3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gj3a2