Class a: All alpha proteins [46456] (289 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) |
Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) automatically mapped to Pfam PF02216 |
Protein automated matches [191290] (4 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [189943] (15 PDB entries) |
Domain d5h7aj1: 5h7a J:35-86 [335977] Other proteins in same PDB: d5h7ab5, d5h7ac5 automated match to d2otke_ |
PDB Entry: 5h7a (more details), 2.7 Å
SCOPe Domain Sequences for d5h7aj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h7aj1 a.8.1.1 (J:35-86) automated matches {Staphylococcus aureus [TaxId: 1280]} fnkeqqnafyeilhlpnlneeqrnafiqslkddpsqsanllaeakklneqqa
Timeline for d5h7aj1:
View in 3D Domains from other chains: (mouse over for more information) d5h7aa1, d5h7aa2, d5h7aa3, d5h7aa4, d5h7ab1, d5h7ab2, d5h7ab3, d5h7ab4, d5h7ab5, d5h7ac1, d5h7ac2, d5h7ac3, d5h7ac4, d5h7ac5, d5h7ad1, d5h7ad2, d5h7ad3, d5h7ad4, d5h7ae1, d5h7ae2, d5h7ae3, d5h7ae4, d5h7af1, d5h7af2, d5h7af3, d5h7af4, d5h7ag1, d5h7ag2, d5h7ag3, d5h7ag4, d5h7ah1, d5h7ah2, d5h7ah3, d5h7ah4, d5h7ai1, d5h7ai2, d5h7ai3, d5h7ai4, d5h7ak1, d5h7ak2, d5h7ak3, d5h7ak4, d5h7al1, d5h7al2, d5h7al3, d5h7al4 |