SCOP 1.59: Domain d1tvra1: 1tvr A:430-558

Lineage for d1tvra1 (1tvr A:430-558)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (57 PDB entries)

8. Domain d1tvra1: 1tvr A:430-558 [33595]
   Other proteins in same PDB: d1tvra2, d1tvrb1

Details for d1tvra1

PDB Entry: 1tvr, 3 Å

PDB Description: hiv-1 rt/9-cl tibo

SCOP Domain Sequences for d1tvra1:

Sequence; same for both SEQRES and ATOM records:

>d1tvra1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

Timeline for d1tvra1:

• d1tvra1 first appeared (with stable ids) in SCOP 1.55
  
• d1tvra1 appears in SCOP 1.57
  
• d1tvra1 appears in SCOP 1.61
  
• d1tvra1 appears in the current release, SCOPe 2.08