SCOPe 2.06: Domain d5uvua1: 5uvu A:352-457

Lineage for d5uvua1 (5uvu A:352-457)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)

8. Domain d5uvua1: 5uvu A:352-457 [335822]
   Other proteins in same PDB: d5uvua2
   automated match to d2ouoa_
   complexed with 8o4

Details for d5uvua1

PDB Entry: 5uvu, 1.66 Å

PDB Description: brd4_bd2_a-1461028

PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d5uvua1:

Sequence; same for both SEQRES and ATOM records:

>d5uvua1 a.29.2.0 (A:352-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskleare
yrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakm

Timeline for d5uvua1:

• d5uvua1 is new in SCOPe 2.06-stable
  
• d5uvua1 appears in SCOPe 2.07
  
• d5uvua1 appears in the current release, SCOPe 2.08