Lineage for d1ekea_ (1eke A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995888Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 995889Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 995910Protein Class II ribonuclease H (RNase HII) [53103] (5 species)
  7. 995914Species Methanococcus jannaschii [TaxId:2190] [53104] (1 PDB entry)
  8. 995915Domain d1ekea_: 1eke A: [33572]
    complexed with mes

Details for d1ekea_

PDB Entry: 1eke (more details), 2 Å

PDB Description: crystal structure of class ii ribonuclease h (rnase hii) with mes ligand
PDB Compounds: (A:) ribonuclease hii

SCOPe Domain Sequences for d1ekea_:

Sequence, based on SEQRES records: (download)

>d1ekea_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Methanococcus jannaschii [TaxId: 2190]}
miiigideagrgpvlgpmvvcafaiekereeelkklgvkdskeltknkraylkkllenlg
yvekrileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkk
fedsfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdi
gsgypsdpktikfledyfkkhkklpdiarthwktckrildkskqt

Sequence, based on observed residues (ATOM records): (download)

>d1ekea_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Methanococcus jannaschii [TaxId: 2190]}
miiigideagrgpvlgpmvvcafaiekereeelkklgvkeltknkraylkkllenlgyve
krileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkkfed
sfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdigsg
ypsdpktikfledyfkkhkklpdiarthwktckrildkskqt

SCOPe Domain Coordinates for d1ekea_:

Click to download the PDB-style file with coordinates for d1ekea_.
(The format of our PDB-style files is described here.)

Timeline for d1ekea_: