Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
Protein Class II ribonuclease H (RNase HII) [53103] (5 species) |
Species Methanococcus jannaschii [TaxId:2190] [53104] (1 PDB entry) |
Domain d1ekea_: 1eke A: [33572] complexed with mes |
PDB Entry: 1eke (more details), 2 Å
SCOPe Domain Sequences for d1ekea_:
Sequence, based on SEQRES records: (download)
>d1ekea_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Methanococcus jannaschii [TaxId: 2190]} miiigideagrgpvlgpmvvcafaiekereeelkklgvkdskeltknkraylkkllenlg yvekrileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkk fedsfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdi gsgypsdpktikfledyfkkhkklpdiarthwktckrildkskqt
>d1ekea_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Methanococcus jannaschii [TaxId: 2190]} miiigideagrgpvlgpmvvcafaiekereeelkklgvkeltknkraylkkllenlgyve krileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkkfed sfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdigsg ypsdpktikfledyfkkhkklpdiarthwktckrildkskqt
Timeline for d1ekea_: