SCOPe 2.06: Domain d5lhua2: 5lhu A:211-284

Lineage for d5lhua2 (5lhu A:211-284)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (16 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [335658] (3 PDB entries)

8. Domain d5lhua2: 5lhu A:211-284 [335659]
   Other proteins in same PDB: d5lhua1
   automated match to d1nh8a2
   complexed with gol, his, so4

Details for d5lhua2

PDB Entry: 5lhu, 2.02 Å

PDB Description: atp phosphoribosyltransferase from mycobacterium tuberculosis in complex with the allosteric inhibitor l-histidine

PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d5lhua2:

Sequence; same for both SEQRES and ATOM records:

>d5lhua2 d.58.5.0 (A:211-284) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qylmldydcprsalkkataitpglesptiapladpdwvairalvprrdvngimdelaaig
akailasdirfcrf

Timeline for d5lhua2:

• d5lhua2 is new in SCOPe 2.06-stable
  
• d5lhua2 appears in SCOPe 2.07
  
• d5lhua2 appears in the current release, SCOPe 2.08