Class b: All beta proteins [48724] (178 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins) |
Protein automated matches [226957] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225382] (12 PDB entries) |
Domain d5ncfb_: 5ncf B: [335555] Other proteins in same PDB: d5ncfa2 automated match to d2iyba_ complexed with 8t5, gol, no3, so4 |
PDB Entry: 5ncf (more details), 1.4 Å
SCOPe Domain Sequences for d5ncfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ncfb_ b.55.1.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl
Timeline for d5ncfb_: