| Class g: Small proteins [56992] (98 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
| Protein automated matches [226968] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries) |
| Domain d5vc1a2: 5vc1 A:119-153 [335486] Other proteins in same PDB: d5vc1a1 automated match to d1g1ta2 complexed with bma, ca, gol, man, nag, peg, pg4 |
PDB Entry: 5vc1 (more details), 1.94 Å
SCOPe Domain Sequences for d5vc1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vc1a2 g.3.11.0 (A:119-153) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tascqpwscsghgecveiinqytcncdvgyygpqc
Timeline for d5vc1a2: