Lineage for d5vc1a2 (5vc1 A:119-153)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2636580Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2636581Protein automated matches [226968] (4 species)
    not a true protein
  7. 2636582Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)
  8. 2636602Domain d5vc1a2: 5vc1 A:119-153 [335486]
    Other proteins in same PDB: d5vc1a1
    automated match to d1g1ta2
    complexed with bma, ca, gol, man, nag, peg, pg4

Details for d5vc1a2

PDB Entry: 5vc1 (more details), 1.94 Å

PDB Description: crystal structure of l-selectin lectin/egf domains
PDB Compounds: (A:) L-selectin

SCOPe Domain Sequences for d5vc1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vc1a2 g.3.11.0 (A:119-153) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tascqpwscsghgecveiinqytcncdvgyygpqc

SCOPe Domain Coordinates for d5vc1a2:

Click to download the PDB-style file with coordinates for d5vc1a2.
(The format of our PDB-style files is described here.)

Timeline for d5vc1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vc1a1