Lineage for d1a16_1 (1a16 1-176)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 316888Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) (S)
  5. 316889Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)
  6. 316890Protein Aminopeptidase P [53096] (1 species)
  7. 316891Species Escherichia coli [TaxId:562] [53097] (4 PDB entries)
  8. 316893Domain d1a16_1: 1a16 1-176 [33548]
    Other proteins in same PDB: d1a16_2
    complexed with mn

Details for d1a16_1

PDB Entry: 1a16 (more details), 2.3 Å

PDB Description: aminopeptidase p from e. coli with the inhibitor pro-leu

SCOP Domain Sequences for d1a16_1:

Sequence, based on SEQRES records: (download)

>d1a16_1 c.55.2.1 (1-176) Aminopeptidase P {Escherichia coli}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

Sequence, based on observed residues (ATOM records): (download)

>d1a16_1 c.55.2.1 (1-176) Aminopeptidase P {Escherichia coli}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsleklrkgsrqnltapatmidwrpvvhemrlfk

SCOP Domain Coordinates for d1a16_1:

Click to download the PDB-style file with coordinates for d1a16_1.
(The format of our PDB-style files is described here.)

Timeline for d1a16_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a16_2