Lineage for d1a16a1 (1a16 A:1-176)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123687Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) (S)
  5. 2123688Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 protein domains)
  6. 2123689Protein Aminopeptidase P [53096] (2 species)
    synonym: Xaa-Pro dipeptidase, prolidase
  7. 2123690Species Escherichia coli [TaxId:562] [53097] (20 PDB entries)
  8. 2123709Domain d1a16a1: 1a16 A:1-176 [33548]
    Other proteins in same PDB: d1a16a2
    complexed with leu, mn, pro

Details for d1a16a1

PDB Entry: 1a16 (more details), 2.3 Å

PDB Description: aminopeptidase p from e. coli with the inhibitor pro-leu
PDB Compounds: (A:) aminopeptidase p

SCOPe Domain Sequences for d1a16a1:

Sequence, based on SEQRES records: (download)

>d1a16a1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

Sequence, based on observed residues (ATOM records): (download)

>d1a16a1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsleklrkgsrqnltapatmidwrpvvhemrlfk

SCOPe Domain Coordinates for d1a16a1:

Click to download the PDB-style file with coordinates for d1a16a1.
(The format of our PDB-style files is described here.)

Timeline for d1a16a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a16a2