SCOPe 2.06: Domain d1chmb1: 1chm B:2-156

Lineage for d1chmb1 (1chm B:2-156)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families)

5. Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins)

6. Protein Creatinase [53094] (2 species)

7. Species Pseudomonas putida [TaxId:303] [53095] (1 PDB entry)

8. Domain d1chmb1: 1chm B:2-156 [33546]
   Other proteins in same PDB: d1chma2, d1chmb2
   complexed with cms

Details for d1chmb1

PDB Entry: 1chm, 1.9 Å

PDB Description: enzymatic mechanism of creatine amidinohydrolase as deduced from crystal structures

PDB Compounds: (B:) creatine amidinohydrolase

SCOPe Domain Sequences for d1chmb1:

Sequence; same for both SEQRES and ATOM records:

>d1chmb1 c.55.2.1 (B:2-156) Creatinase {Pseudomonas putida [TaxId: 303]}
qmpktlrirngdkvrstfsaqeyanrqarlrahlaaenidaaiftsyhninyysdflycs
fgrpyalvvteddvisisanidggqpwrrtvgtdnivytdwqrdnyfaaiqqalpkarri
giehdhlnlqnrdklaarypdaelvdvaaacmrmr

Timeline for d1chmb1:

• d1chmb1 first appeared (with stable ids) in SCOP 1.55
  
• d1chmb1 appears in SCOPe 2.05
  
• d1chmb1 appears in SCOPe 2.07
  
• d1chmb1 appears in the current release, SCOPe 2.08