Lineage for d1chma1 (1chm A:2-156)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836701Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) (S)
  5. 836702Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)
  6. 836750Protein Creatinase [53094] (2 species)
  7. 836754Species Pseudomonas putida [TaxId:303] [53095] (1 PDB entry)
  8. 836755Domain d1chma1: 1chm A:2-156 [33545]
    Other proteins in same PDB: d1chma2, d1chmb2

Details for d1chma1

PDB Entry: 1chm (more details), 1.9 Å

PDB Description: enzymatic mechanism of creatine amidinohydrolase as deduced from crystal structures
PDB Compounds: (A:) creatine amidinohydrolase

SCOP Domain Sequences for d1chma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chma1 c.55.2.1 (A:2-156) Creatinase {Pseudomonas putida [TaxId: 303]}
qmpktlrirngdkvrstfsaqeyanrqarlrahlaaenidaaiftsyhninyysdflycs
fgrpyalvvteddvisisanidggqpwrrtvgtdnivytdwqrdnyfaaiqqalpkarri
giehdhlnlqnrdklaarypdaelvdvaaacmrmr

SCOP Domain Coordinates for d1chma1:

Click to download the PDB-style file with coordinates for d1chma1.
(The format of our PDB-style files is described here.)

Timeline for d1chma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1chma2