Lineage for d1chma1 (1chm A:2-156)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2462791Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) (S)
  5. 2462792Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 protein domains)
  6. 2462834Protein Creatinase [53094] (2 species)
  7. 2462838Species Pseudomonas putida [TaxId:303] [53095] (1 PDB entry)
  8. 2462839Domain d1chma1: 1chm A:2-156 [33545]
    Other proteins in same PDB: d1chma2, d1chmb2
    complexed with cms

Details for d1chma1

PDB Entry: 1chm (more details), 1.9 Å

PDB Description: enzymatic mechanism of creatine amidinohydrolase as deduced from crystal structures
PDB Compounds: (A:) creatine amidinohydrolase

SCOPe Domain Sequences for d1chma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chma1 c.55.2.1 (A:2-156) Creatinase {Pseudomonas putida [TaxId: 303]}
qmpktlrirngdkvrstfsaqeyanrqarlrahlaaenidaaiftsyhninyysdflycs
fgrpyalvvteddvisisanidggqpwrrtvgtdnivytdwqrdnyfaaiqqalpkarri
giehdhlnlqnrdklaarypdaelvdvaaacmrmr

SCOPe Domain Coordinates for d1chma1:

Click to download the PDB-style file with coordinates for d1chma1.
(The format of our PDB-style files is described here.)

Timeline for d1chma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1chma2