| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) ![]() |
| Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins) |
| Protein Creatinase [53094] (2 species) |
| Species Pseudomonas putida [TaxId:303] [53095] (1 PDB entry) |
| Domain d1chma1: 1chm A:2-156 [33545] Other proteins in same PDB: d1chma2, d1chmb2 |
PDB Entry: 1chm (more details), 1.9 Å
SCOP Domain Sequences for d1chma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1chma1 c.55.2.1 (A:2-156) Creatinase {Pseudomonas putida}
qmpktlrirngdkvrstfsaqeyanrqarlrahlaaenidaaiftsyhninyysdflycs
fgrpyalvvteddvisisanidggqpwrrtvgtdnivytdwqrdnyfaaiqqalpkarri
giehdhlnlqnrdklaarypdaelvdvaaacmrmr
Timeline for d1chma1: