Lineage for d1bo5z2 (1bo5 Z:254-499)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181999Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 182000Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 182181Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 182182Protein Glycerol kinase [53090] (1 species)
  7. 182183Species Escherichia coli [TaxId:562] [53091] (12 PDB entries)
  8. 182225Domain d1bo5z2: 1bo5 Z:254-499 [33544]

Details for d1bo5z2

PDB Entry: 1bo5 (more details), 3.2 Å

PDB Description: crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate.

SCOP Domain Sequences for d1bo5z2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bo5z2 c.55.1.4 (Z:254-499) Glycerol kinase {Escherichia coli}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweeh

SCOP Domain Coordinates for d1bo5z2:

Click to download the PDB-style file with coordinates for d1bo5z2.
(The format of our PDB-style files is described here.)

Timeline for d1bo5z2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bo5z1