Class b: All beta proteins [48724] (177 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) |
Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins) automatically mapped to Pfam PF00576 |
Protein automated matches [190376] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187223] (17 PDB entries) |
Domain d5h0vb1: 5h0v B:11-124 [335337] Other proteins in same PDB: d5h0va2, d5h0vb2, d5h0vc2, d5h0vd2 automated match to d5ezpe_ complexed with mg, mpd |
PDB Entry: 5h0v (more details), 1.58 Å
SCOPe Domain Sequences for d5h0vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h0vb1 b.3.4.1 (B:11-124) automated matches {Human (Homo sapiens) [TaxId: 9606]} plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk veidtksywkalgispfaehaevvftandsgprrytiaallspysysttavvtn
Timeline for d5h0vb1: