SCOPe 2.06: Domain d5h0vb1: 5h0v B:11-124

Lineage for d5h0vb1 (5h0v B:11-124)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein automated matches [190376] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187223] (17 PDB entries)

8. Domain d5h0vb1: 5h0v B:11-124 [335337]
   Other proteins in same PDB: d5h0va2, d5h0vb2, d5h0vc2, d5h0vd2
   automated match to d5ezpe_
   complexed with mg, mpd

Details for d5h0vb1

PDB Entry: 5h0v, 1.58 Å

PDB Description: crystal structure of h88a mutated human transthyretin

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d5h0vb1:

Sequence; same for both SEQRES and ATOM records:

>d5h0vb1 b.3.4.1 (B:11-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
veidtksywkalgispfaehaevvftandsgprrytiaallspysysttavvtn

Timeline for d5h0vb1:

• d5h0vb1 is new in SCOPe 2.06-stable
  
• d5h0vb1 appears in SCOPe 2.07
  
• d5h0vb1 appears in the current release, SCOPe 2.08