| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) ![]() Pfam PF16454 |
| Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins) |
| Protein automated matches [310859] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [311240] (9 PDB entries) |
| Domain d5vlrb_: 5vlr B: [335282] automated match to d2v1yb_ complexed with 9em |
PDB Entry: 5vlr (more details), 2.8 Å
SCOPe Domain Sequences for d5vlrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vlrb_ h.4.21.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yqqdqvvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnet
ikifeeqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlk
kqaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlgn
Timeline for d5vlrb_: