Lineage for d5vlrb_ (5vlr B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3042247Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 3042445Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) (S)
    Pfam PF16454
  5. 3042446Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins)
  6. 3042450Protein automated matches [310859] (2 species)
    not a true protein
  7. 3042460Species Human (Homo sapiens) [TaxId:9606] [311240] (9 PDB entries)
  8. 3042466Domain d5vlrb_: 5vlr B: [335282]
    automated match to d2v1yb_
    complexed with 9em

Details for d5vlrb_

PDB Entry: 5vlr (more details), 2.8 Å

PDB Description: crystal structure of pi3k delta in complex with a trifluoro-ethyl- pyrazol-pyrolotriazine inhibitor
PDB Compounds: (B:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d5vlrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vlrb_ h.4.21.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yqqdqvvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnet
ikifeeqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlk
kqaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlgn

SCOPe Domain Coordinates for d5vlrb_:

Click to download the PDB-style file with coordinates for d5vlrb_.
(The format of our PDB-style files is described here.)

Timeline for d5vlrb_: