Lineage for d1glcg2 (1glc G:254-499)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605693Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 1605694Protein Glycerol kinase [53090] (2 species)
  7. 1605736Species Escherichia coli [TaxId:562] [53091] (13 PDB entries)
  8. 1605774Domain d1glcg2: 1glc G:254-499 [33520]
    Other proteins in same PDB: d1glcf_
    complexed with adp, g3h, mg, zn

Details for d1glcg2

PDB Entry: 1glc (more details), 2.65 Å

PDB Description: cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation
PDB Compounds: (G:) glycerol kinase

SCOPe Domain Sequences for d1glcg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glcg2 c.55.1.4 (G:254-499) Glycerol kinase {Escherichia coli [TaxId: 562]}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweeh

SCOPe Domain Coordinates for d1glcg2:

Click to download the PDB-style file with coordinates for d1glcg2.
(The format of our PDB-style files is described here.)

Timeline for d1glcg2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1glcg1
View in 3D
Domains from other chains:
(mouse over for more information)
d1glcf_