Lineage for d1glcg2 (1glc G:254-499)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181999Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 182000Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 182181Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 182182Protein Glycerol kinase [53090] (1 species)
  7. 182183Species Escherichia coli [TaxId:562] [53091] (12 PDB entries)
  8. 182205Domain d1glcg2: 1glc G:254-499 [33520]
    Other proteins in same PDB: d1glcf_

Details for d1glcg2

PDB Entry: 1glc (more details), 2.65 Å

PDB Description: cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation

SCOP Domain Sequences for d1glcg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glcg2 c.55.1.4 (G:254-499) Glycerol kinase {Escherichia coli}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweeh

SCOP Domain Coordinates for d1glcg2:

Click to download the PDB-style file with coordinates for d1glcg2.
(The format of our PDB-style files is described here.)

Timeline for d1glcg2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1glcg1
View in 3D
Domains from other chains:
(mouse over for more information)
d1glcf_