Lineage for d1glfz1 (1glf Z:3-253)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488063Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) (S)
    duplication contains two domains of this fold
  5. 488295Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 488296Protein Glycerol kinase [53090] (1 species)
  7. 488297Species Escherichia coli [TaxId:562] [53091] (12 PDB entries)
  8. 488314Domain d1glfz1: 1glf Z:3-253 [33515]

Details for d1glfz1

PDB Entry: 1glf (more details), 2.62 Å

PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation

SCOP Domain Sequences for d1glfz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glfz1 c.55.1.4 (Z:3-253) Glycerol kinase {Escherichia coli}
kkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlve
vlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgled
yirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtd
ytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgi
agdqqaalfgq

SCOP Domain Coordinates for d1glfz1:

Click to download the PDB-style file with coordinates for d1glfz1.
(The format of our PDB-style files is described here.)

Timeline for d1glfz1: