Lineage for d5k54a_ (5k54 A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. Protein automated matches [190281] (5 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187709] (50 PDB entries)
  8. Domain d5k54a_: 5k54 A: [335143]
    automated match to d1fsaa_
    mutant

Details for d5k54a_

PDB Entry: 5k54 (more details), 1.7200000000000002 Å

PDB Description: human muscle fructose-1,6-bisphosphatase e69q mutant in active r-state
PDB Compounds: (A:) Fructose-1,6-bisphosphatase isozyme 2

SCOPe Domain Sequences for d5k54a_:

Sequence, based on SEQRES records: (download)

>d5k54a_ e.7.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmltltryvmekgrqakgtgeltqllnsmltaikaissavrkaglahlygiagsvnvtgd
qvkkldvlsnslvinmlqssystcvlvseenkdaiitakekrgkyvvcfdpldgssnidc
lasigtifaiyrktsedepsekdalqcgrnivaagyalygsatlvalstgqgvdlfmldp
algefvlvekdvkikkkgkiyslnegyakyfdaatteyvqkkkfpedgsapygaryvgsm
vadvhrtlvyggiflypanqkspkgklrllyecnpvayiieqagglattgtqpvldvkpe
aihqrvplilgspedvqeyltcvqk

Sequence, based on observed residues (ATOM records): (download)

>d5k54a_ e.7.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmltltryvmeltqllnsmltaikaissavvkkldvlsnslvinmlqssystcvlvseen
kdaiitakrgkyvvcfdpldgssnidclasigtifaiyrkdalqcgrnivaagyalygsa
tlvalstgqgvdlfmldpalgefvlvekdvkikkkgkiyslnegyakyfdaatteyvqkk
kfpedgsapygaryvgsmvadvhrtlvyggiflypanqkspkgklrllyecnpvayiieq
agglattgtqpvldvkpeaihqrvplilgspedvqeyltcvqk

SCOPe Domain Coordinates for d5k54a_ are not available.

Timeline for d5k54a_: