PDB entry 5k54

View 5k54 on RCSB PDB site
Description: Human muscle fructose-1,6-bisphosphatase E69Q mutant in active R-state
Class: hydrolase
Keywords: Hydrolase, carbohydrate metabolism, glyconeogenesis, muscle izozyme, FBPase, R-state, Leucine lock, E69Q mutant
Deposited on 2016-05-23, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-1,6-bisphosphatase isozyme 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FBP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k54a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k54A (A:)
    tdrspfetdmltltryvmekgrqakgtgeltqllnsmltaikaissavrkaglahlygia
    gsvnvtgdqvkkldvlsnslvinmlqssystcvlvseenkdaiitakekrgkyvvcfdpl
    dgssnidclasigtifaiyrktsedepsekdalqcgrnivaagyalygsatlvalstgqg
    vdlfmldpalgefvlvekdvkikkkgkiyslnegyakyfdaatteyvqkkkfpedgsapy
    garyvgsmvadvhrtlvyggiflypanqkspkgklrllyecnpvayiieqagglattgtq
    pvldvkpeaihqrvplilgspedvqeyltcvqknqags
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k54A (A:)
    dmltltryvmeltqllnsmltaikaissavvkkldvlsnslvinmlqssystcvlvseen
    kdaiitakrgkyvvcfdpldgssnidclasigtifaiyrkdalqcgrnivaagyalygsa
    tlvalstgqgvdlfmldpalgefvlvekdvkikkkgkiyslnegyakyfdaatteyvqkk
    kfpedgsapygaryvgsmvadvhrtlvyggiflypanqkspkgklrllyecnpvayiieq
    agglattgtqpvldvkpeaihqrvplilgspedvqeyltcvqk