Lineage for d1glfy2 (1glf Y:254-500)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 316625Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) (S)
    duplication contains two domains of this fold
  5. 316827Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 316828Protein Glycerol kinase [53090] (1 species)
  7. 316829Species Escherichia coli [TaxId:562] [53091] (12 PDB entries)
  8. 316845Domain d1glfy2: 1glf Y:254-500 [33514]

Details for d1glfy2

PDB Entry: 1glf (more details), 2.62 Å

PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation

SCOP Domain Sequences for d1glfy2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glfy2 c.55.1.4 (Y:254-500) Glycerol kinase {Escherichia coli}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweehd

SCOP Domain Coordinates for d1glfy2:

Click to download the PDB-style file with coordinates for d1glfy2.
(The format of our PDB-style files is described here.)

Timeline for d1glfy2: