SCOPe 2.08: Domain d1glfy2: 1glf Y:254-500

Lineage for d1glfy2 (1glf Y:254-500)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.4: Glycerol kinase [53089] (1 protein)

6. Protein Glycerol kinase [53090] (2 species)

7. Species Escherichia coli [TaxId:562] [53091] (14 PDB entries)

8. Domain d1glfy2: 1glf Y:254-500 [33514]
   complexed with adp, gol, po4; mutant

Details for d1glfy2

PDB Entry: 1glf, 2.62 Å

PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation

PDB Compounds: (Y:) protein (glycerol kinase)

SCOPe Domain Sequences for d1glfy2:

Sequence; same for both SEQRES and ATOM records:

>d1glfy2 c.55.1.4 (Y:254-500) Glycerol kinase {Escherichia coli [TaxId: 562]}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweehd

Timeline for d1glfy2:

• d1glfy2 first appeared (with stable ids) in SCOP 1.55
  
• d1glfy2 appears in SCOPe 2.07