Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.4: Glycerol kinase [53089] (1 protein) |
Protein Glycerol kinase [53090] (2 species) |
Species Escherichia coli [TaxId:562] [53091] (14 PDB entries) |
Domain d1glfy2: 1glf Y:254-500 [33514] complexed with adp, gol, po4; mutant |
PDB Entry: 1glf (more details), 2.62 Å
SCOPe Domain Sequences for d1glfy2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1glfy2 c.55.1.4 (Y:254-500) Glycerol kinase {Escherichia coli [TaxId: 562]} lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra maweehd
Timeline for d1glfy2: