SCOPe 2.07: Domain d5k1la_: 5k1l A:

Lineage for d5k1la_ (5k1l A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (44 species)
   not a true protein

7. Species Amphitrite ornata [TaxId:129555] [189339] (41 PDB entries)

8. Domain d5k1la_: 5k1l A: [335132]
   automated match to d4kn3a_
   complexed with bzi, hem, so4

Details for d5k1la_

PDB Entry: 5k1l, 1.08 Å

PDB Description: dehaloperoxidase b from amphitrite ornata: benzimidazole complex

PDB Compounds: (A:) Dehaloperoxidase B

SCOPe Domain Sequences for d5k1la_:

Sequence; same for both SEQRES and ATOM records:

>d5k1la_ a.1.1.2 (A:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d5k1la_:

• d5k1la_ first appeared in SCOPe 2.06
  
• d5k1la_ appears in the current release, SCOPe 2.08