Lineage for d5k0ra_ (5k0r A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2437126Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2437127Protein automated matches [190048] (31 species)
    not a true protein
  7. 2437345Species Shewanella oneidensis [TaxId:211586] [187764] (13 PDB entries)
  8. 2437351Domain d5k0ra_: 5k0r A: [335080]
    automated match to d3kruc_
    complexed with 8k6, fnr

Details for d5k0ra_

PDB Entry: 5k0r (more details), 1.45 Å

PDB Description: crystal structure of reduced shewanella yellow enzyme 4 (sye4)
PDB Compounds: (A:) NAD(P)H:flavin oxidoreductase Sye4

SCOPe Domain Sequences for d5k0ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k0ra_ c.1.4.0 (A:) automated matches {Shewanella oneidensis [TaxId: 211586]}
svenlfdtyklndtitlknrilmapltrcmadanlvptddmvayyarraeagliiseati
irpdaqgypntpgiftqaqiagwrkvtdavhanggkifvqlwhtgrvahphffgggdvla
psaqkiegsvprmreltyvtpkavtvediqglvrdyakaaenvieagfdgveihgangyl
idqflhhdsnrrtdeyggtpvnmsrfalevvdaiiarighdrtglrispgayfnmasdsr
drvvfdyllpelekrdlafvhigifddsiefdylggtassyvrahygktlvgvgsysaet
askaiaedkfdliaigrpfianpdyvakvrnseelvaysdemlasli

SCOPe Domain Coordinates for d5k0ra_:

Click to download the PDB-style file with coordinates for d5k0ra_.
(The format of our PDB-style files is described here.)

Timeline for d5k0ra_: