SCOPe 2.07: Domain d5kbxb_: 5kbx B:

Lineage for d5kbxb_ (5kbx B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (84 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [335058] (1 PDB entry)

8. Domain d5kbxb_: 5kbx B: [335064]
   Other proteins in same PDB: d5kbxa_
   automated match to d4euka_
   complexed with gol, po4

Details for d5kbxb_

PDB Entry: 5kbx, 2.8 Å

PDB Description: co-crystal structure of the saccharomyces cerevisiae histidine phosphotransfer signaling protein ypd1 and the receiver domain of its downstream response regulator ssk1

PDB Compounds: (B:) Osmolarity two-component system protein SSK1

SCOPe Domain Sequences for d5kbxb_:

Sequence, based on SEQRES records:

>d5kbxb_ c.23.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kvfpkinvlivednvinqailgsflrkhkisyklakngqeavniwkegglhlifmdlqlp
vlsgieaakqirdfekqngigiqkslnnshsnlekgtskrfsqapviivaltasnsqmdk
rkallsgcndyltkpvnlhalskkitewgcmqalidfdswk

Sequence, based on observed residues (ATOM records):

>d5kbxb_ c.23.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kvfpkinvlivednvinqailgsflrkhkisyklakngqeavniwkegglhlifmdlqlp
vlsgieaakqirdfekqngigskrfsqapviivaltasnsqmdkrkallsgcndyltkpv
nlhalskkitewgcmqalidfdswk

Timeline for d5kbxb_:

• d5kbxb_ first appeared in SCOPe 2.06
  
• d5kbxb_ appears in the current release, SCOPe 2.08