Lineage for d1bu6y2 (1bu6 Y:254-500)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124261Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 124430Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 124431Protein Glycerol kinase [53090] (1 species)
  7. 124432Species Escherichia coli [TaxId:562] [53091] (12 PDB entries)
  8. 124438Domain d1bu6y2: 1bu6 Y:254-500 [33504]

Details for d1bu6y2

PDB Entry: 1bu6 (more details), 2.37 Å

PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation

SCOP Domain Sequences for d1bu6y2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bu6y2 c.55.1.4 (Y:254-500) Glycerol kinase {Escherichia coli}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweehd

SCOP Domain Coordinates for d1bu6y2:

Click to download the PDB-style file with coordinates for d1bu6y2.
(The format of our PDB-style files is described here.)

Timeline for d1bu6y2: