SCOPe 2.01: Domain d1bu6o1: 1bu6 O:3-253

Lineage for d1bu6o1 (1bu6 O:3-253)

Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
duplication contains two domains of this fold
Family c.55.1.4: Glycerol kinase [53089] (1 protein)
Protein Glycerol kinase [53090] (2 species)
Species Escherichia coli [TaxId:562] [53091] (13 PDB entries)
Domain d1bu6o1: 1bu6 O:3-253 [33499]
complexed with gol, so4; mutant

Details for d1bu6o1

PDB Entry: 1bu6 (more details), 2.37 Å

PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation

PDB Compounds: (O:) protein (glycerol kinase)

SCOPe Domain Sequences for d1bu6o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bu6o1 c.55.1.4 (O:3-253) Glycerol kinase {Escherichia coli [TaxId: 562]}
kkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlve
vltkadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgled
yirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtd
ytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgi
agdqqaalfgq

SCOPe Domain Coordinates for d1bu6o1:

Click to download the PDB-style file with coordinates for d1bu6o1.
(The format of our PDB-style files is described here.)

Timeline for d1bu6o1: