Lineage for d1bg3a3 (1bg3 A:466-670)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605592Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 1605614Protein Mammalian type I hexokinase [53086] (2 species)
    further duplication: consists of two very similar lobes
  7. 1605684Species Norway rat (Rattus norvegicus) [TaxId:10116] [53088] (1 PDB entry)
  8. 1605687Domain d1bg3a3: 1bg3 A:466-670 [33493]
    complexed with bgc, ca, g6p

Details for d1bg3a3

PDB Entry: 1bg3 (more details), 2.8 Å

PDB Description: rat brain hexokinase type i complex with glucose and inhibitor glucose-6-phosphate
PDB Compounds: (A:) hexokinase

SCOPe Domain Sequences for d1bg3a3:

Sequence, based on SEQRES records: (download)

>d1bg3a3 c.55.1.3 (A:466-670) Mammalian type I hexokinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qhrqieetlahfrlskqtlmevkkrlrtememglrketnskatvkmlpsfvrsipdgteh
gdflaldlggtnfrvllvkirsgkkrtvemhnkiysipleimqgtgdelfdhivscisdf
ldymgikgprmplgftfsfpchqtnldcgiliswtkgfkatdceghdvasllrdavkrre
efdldvvavvndtvgtmmtcayeep

Sequence, based on observed residues (ATOM records): (download)

>d1bg3a3 c.55.1.3 (A:466-670) Mammalian type I hexokinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qhrqieetlahfrlskqtlmevkkrlrtememglrketnskatvkmlpsfvrsipdgteh
gdflaldlggtnfrvllvkirsrtvemhnkiysipleimqgtgdelfdhivscisdfldy
mgikgprmplgftfsfpchqtnldcgiliswtkgfkatdceghdvasllrdavkrreefd
ldvvavvndtvgtmmtcayeep

SCOPe Domain Coordinates for d1bg3a3:

Click to download the PDB-style file with coordinates for d1bg3a3.
(The format of our PDB-style files is described here.)

Timeline for d1bg3a3: