Lineage for d1hkbb4 (1hkb B:671-914)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995432Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 995446Protein Mammalian type I hexokinase [53086] (2 species)
    further duplication: consists of two very similar lobes
  7. 995447Species Human (Homo sapiens) [TaxId:9606] [53087] (5 PDB entries)
  8. 995471Domain d1hkbb4: 1hkb B:671-914 [33486]
    complexed with bgc, ca, g6p

Details for d1hkbb4

PDB Entry: 1hkb (more details), 2.8 Å

PDB Description: crystal structure of recombinant human brain hexokinase type i complexed with glucose and glucose-6-phosphate
PDB Compounds: (B:) d-glucose 6-phosphotransferase

SCOPe Domain Sequences for d1hkbb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkbb4 c.55.1.3 (B:671-914) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}
tcevglivgtgsnacymeemknvemvegdqgqmcinmewgafgdngclddirthydrlvd
eyslnagkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrgifetkflsqi
esdrlallqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaavvdkirenrg
ldrlnvtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkgaalitavgvr
lrte

SCOPe Domain Coordinates for d1hkbb4:

Click to download the PDB-style file with coordinates for d1hkbb4.
(The format of our PDB-style files is described here.)

Timeline for d1hkbb4: