Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (24 species) not a true protein |
Species Enterovirus a71 [TaxId:39054] [313489] (5 PDB entries) |
Domain d5gswc_: 5gsw C: [334837] automated match to d2vb0a_ complexed with 5gi |
PDB Entry: 5gsw (more details), 3.19 Å
SCOPe Domain Sequences for d5gswc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gswc_ b.47.1.0 (C:) automated matches {Enterovirus a71 [TaxId: 39054]} gpsldfalsllrrnvrqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnvldav elvdeqgvsleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvv qygflnlsgkpthrtmmynfptkagqcggvvtsvgkiigihiggngrqgfcaglkrsyfa s
Timeline for d5gswc_:
View in 3D Domains from other chains: (mouse over for more information) d5gswa_, d5gswb_, d5gswd_, d5gswe_ |