Lineage for d5gswc_ (5gsw C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066902Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2066903Protein automated matches [190438] (24 species)
    not a true protein
  7. 2066917Species Enterovirus a71 [TaxId:39054] [313489] (5 PDB entries)
  8. 2066928Domain d5gswc_: 5gsw C: [334837]
    automated match to d2vb0a_
    complexed with 5gi

Details for d5gswc_

PDB Entry: 5gsw (more details), 3.19 Å

PDB Description: crystal structure of ev71 3c in complex with n69s 1.8k
PDB Compounds: (C:) 3C protein

SCOPe Domain Sequences for d5gswc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gswc_ b.47.1.0 (C:) automated matches {Enterovirus a71 [TaxId: 39054]}
gpsldfalsllrrnvrqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnvldav
elvdeqgvsleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvv
qygflnlsgkpthrtmmynfptkagqcggvvtsvgkiigihiggngrqgfcaglkrsyfa
s

SCOPe Domain Coordinates for d5gswc_:

Click to download the PDB-style file with coordinates for d5gswc_.
(The format of our PDB-style files is described here.)

Timeline for d5gswc_: