SCOP 1.67: Domain d1hkca4: 1hkc A:671-914

Lineage for d1hkca4 (1hkc A:671-914)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families)
   duplication contains two domains of this fold

5. Family c.55.1.3: Hexokinase [53083] (3 proteins)

6. Protein Mammalian type I hexokinase [53086] (2 species)
   further duplication: consists of two very similar lobes

7. Species Human (Homo sapiens) [TaxId:9606] [53087] (5 PDB entries)

8. Domain d1hkca4: 1hkc A:671-914 [33478]
   complexed with glc, k, po4

Details for d1hkca4

PDB Entry: 1hkc, 2.8 Å

PDB Description: recombinant human hexokinase type i complexed with glucose and phosphate

SCOP Domain Sequences for d1hkca4:

Sequence; same for both SEQRES and ATOM records:

>d1hkca4 c.55.1.3 (A:671-914) Mammalian type I hexokinase {Human (Homo sapiens)}
tcevglivgtgsnacymeemknvemvegdqgqmcinmewgafgdngclddirthydrlvn
eyslnagkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrgifetkflsqi
esdrlallqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaavvdkirenrg
ldrlnvtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkgaalitavgvr
lrte

Timeline for d1hkca4:

• d1hkca4 first appeared (with stable ids) in SCOP 1.55
  
• d1hkca4 appears in SCOP 1.65
  
• d1hkca4 appears in SCOP 1.69
  
• d1hkca4 appears in the current release, SCOPe 2.08